Lineage for d3t8aa_ (3t8a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099728Protein automated matches [190669] (6 species)
    not a true protein
  7. 2099762Species Mycobacterium tuberculosis [TaxId:1773] [256094] (1 PDB entry)
  8. 2099763Domain d3t8aa_: 3t8a A: [249833]
    automated match to d1rjnb_
    complexed with s0n

Details for d3t8aa_

PDB Entry: 3t8a (more details), 2.25 Å

PDB Description: crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa
PDB Compounds: (A:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d3t8aa_:

Sequence, based on SEQRES records: (download)

>d3t8aa_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrlaymtdeaveg

Sequence, based on observed residues (ATOM records): (download)

>d3t8aa_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdrlhilevqrlirfmpkvviclvngwaaggg
hslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytae
qmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfagea
trlaymtdeaveg

SCOPe Domain Coordinates for d3t8aa_:

Click to download the PDB-style file with coordinates for d3t8aa_.
(The format of our PDB-style files is described here.)

Timeline for d3t8aa_: