Lineage for d1chpg_ (1chp G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667368Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 667369Species Vibrio cholerae [TaxId:666] [50209] (23 PDB entries)
  8. 667448Domain d1chpg_: 1chp G: [24983]

Details for d1chpg_

PDB Entry: 1chp (more details), 2 Å

PDB Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
PDB Compounds: (G:) cholera toxin b pentamer

SCOP Domain Sequences for d1chpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chpg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1chpg_:

Click to download the PDB-style file with coordinates for d1chpg_.
(The format of our PDB-style files is described here.)

Timeline for d1chpg_: