SCOPe 2.06: Domain d1chpe_: 1chp E:

Lineage for d1chpe_ (1chp E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Cholera toxin [50208] (2 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (26 PDB entries)
   Uniprot P01556 22-124

8. Domain d1chpe_: 1chp E: [24981]
   complexed with cl; mutant

Details for d1chpe_

PDB Entry: 1chp, 2 Å

PDB Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants

PDB Compounds: (E:) cholera toxin b pentamer

SCOPe Domain Sequences for d1chpe_:

Sequence; same for both SEQRES and ATOM records:

>d1chpe_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1chpe_:

• d1chpe_ first appeared (with stable ids) in SCOP 1.55
  
• d1chpe_ appears in SCOPe 2.05
  
• d1chpe_ appears in SCOPe 2.07
  
• d1chpe_ appears in the current release, SCOPe 2.08