![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries) |
![]() | Domain d3t6xb1: 3t6x B:1-131 [249808] automated match to d1gyca1 complexed with cu, gol, nag, per, so4 |
PDB Entry: 3t6x (more details), 2.15 Å
SCOPe Domain Sequences for d3t6xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6xb1 b.6.1.0 (B:1-131) automated matches {Steccherinum ochraceum [TaxId: 92696]} vqigpvtdlhivnadivpdgfvrpavnaggtfpgpviagnvgdnfqivtfnqliecsmlv dtsihwhgefqkgtnwadgpafitqcpiivgnsfsynfnvpgmagtywyhshlttqycdg lrgpfvvydpn
Timeline for d3t6xb1: