Lineage for d3t6vc1 (3t6v C:1-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368310Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries)
  8. 2368317Domain d3t6vc1: 3t6v C:1-131 [249793]
    automated match to d1gyca1
    complexed with cbs, cu, gol, so4

Details for d3t6vc1

PDB Entry: 3t6v (more details), 2 Å

PDB Description: Crystal Structure of Laccase from Steccherinum ochraceum
PDB Compounds: (C:) laccase

SCOPe Domain Sequences for d3t6vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6vc1 b.6.1.0 (C:1-131) automated matches {Steccherinum ochraceum [TaxId: 92696]}
vqigpvtdlhivnadivpdgfvrpavnaggtfpgpviagnvgdnfqivtfnqliecsmlv
dtsihwhgefqkgtnwadgpafitqcpiivgnsfsynfnvpgmagtywyhshlttqycdg
lrgpfvvydpn

SCOPe Domain Coordinates for d3t6vc1:

Click to download the PDB-style file with coordinates for d3t6vc1.
(The format of our PDB-style files is described here.)

Timeline for d3t6vc1: