Lineage for d2chbg_ (2chb G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13634Protein Cholera toxin [50208] (1 species)
  7. 13635Species Vibrio cholerae [TaxId:666] [50209] (8 PDB entries)
  8. 13644Domain d2chbg_: 2chb G: [24978]

Details for d2chbg_

PDB Entry: 2chb (more details), 2 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d2chbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chbg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d2chbg_:

Click to download the PDB-style file with coordinates for d2chbg_.
(The format of our PDB-style files is described here.)

Timeline for d2chbg_: