Lineage for d3t4mc1 (3t4m C:1-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820400Domain d3t4mc1: 3t4m C:1-209 [249779]
    Other proteins in same PDB: d3t4ma2, d3t4mb2, d3t4mc2, d3t4md2, d3t4me2, d3t4mf2, d3t4mg2, d3t4mh2, d3t4mi2, d3t4mj2
    automated match to d2ymea_
    complexed with ca, mpd, mrd, nag

Details for d3t4mc1

PDB Entry: 3t4m (more details), 3 Å

PDB Description: ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)
PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3t4mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t4mc1 b.96.1.0 (C:1-209) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvthdgsvqylpa
qrlsfmcdptgvdseegatcavkfgswsysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvrfyecckepypdvnlvvkfrerra

SCOPe Domain Coordinates for d3t4mc1:

Click to download the PDB-style file with coordinates for d3t4mc1.
(The format of our PDB-style files is described here.)

Timeline for d3t4mc1: