Lineage for d2chbf_ (2chb F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667368Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 667369Species Vibrio cholerae [TaxId:666] [50209] (23 PDB entries)
  8. 667442Domain d2chbf_: 2chb F: [24977]

Details for d2chbf_

PDB Entry: 2chb (more details), 2 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide
PDB Compounds: (F:) cholera toxin

SCOP Domain Sequences for d2chbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chbf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d2chbf_:

Click to download the PDB-style file with coordinates for d2chbf_.
(The format of our PDB-style files is described here.)

Timeline for d2chbf_: