SCOP 1.67: Domain d2chbf_: 2chb F:

Lineage for d2chbf_ (2chb F:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)

8. Domain d2chbf_: 2chb F: [24977]

Details for d2chbf_

PDB Entry: 2chb, 2 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d2chbf_:

Sequence; same for both SEQRES and ATOM records:

>d2chbf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d2chbf_:

• d2chbf_ first appeared (with stable ids) in SCOP 1.55
  
• d2chbf_ appears in SCOP 1.65
  
• d2chbf_ appears in SCOP 1.69
  
• d2chbf_ appears in the current release, SCOPe 2.08