Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3t2qd2: 3t2q D:220-333 [249762] Other proteins in same PDB: d3t2qa1, d3t2qa3, d3t2qa5, d3t2qb1, d3t2qb3, d3t2qb5, d3t2qc1, d3t2qc3, d3t2qc5, d3t2qd1, d3t2qd3, d3t2qd5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3t2q (more details), 2.4 Å
SCOPe Domain Sequences for d3t2qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2qd2 b.1.4.0 (D:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3t2qd2:
View in 3D Domains from same chain: (mouse over for more information) d3t2qd1, d3t2qd3, d3t2qd4, d3t2qd5 |