Lineage for d3t2qb1 (3t2q B:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384768Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2384826Domain d3t2qb1: 3t2q B:9-219 [249751]
    Other proteins in same PDB: d3t2qa2, d3t2qa3, d3t2qa4, d3t2qa5, d3t2qb2, d3t2qb3, d3t2qb4, d3t2qb5, d3t2qc2, d3t2qc3, d3t2qc4, d3t2qc5, d3t2qd2, d3t2qd3, d3t2qd4, d3t2qd5
    automated match to d1f49a3
    complexed with 149, dms, mg, na

Details for d3t2qb1

PDB Entry: 3t2q (more details), 2.4 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with galactonolactone
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3t2qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2qb1 b.18.1.0 (B:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t2qb1:

Click to download the PDB-style file with coordinates for d3t2qb1.
(The format of our PDB-style files is described here.)

Timeline for d3t2qb1: