| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (4 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d3t2qa4: 3t2q A:626-730 [249749] Other proteins in same PDB: d3t2qa1, d3t2qa3, d3t2qa5, d3t2qb1, d3t2qb3, d3t2qb5, d3t2qc1, d3t2qc3, d3t2qc5, d3t2qd1, d3t2qd3, d3t2qd5 automated match to d1jz8a2 complexed with 149, dms, mg, na |
PDB Entry: 3t2q (more details), 2.4 Å
SCOPe Domain Sequences for d3t2qa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2qa4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3t2qa4:
View in 3DDomains from same chain: (mouse over for more information) d3t2qa1, d3t2qa2, d3t2qa3, d3t2qa5 |