| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
| Protein automated matches [190075] (125 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
| Domain d3t2qa3: 3t2q A:334-625 [249748] Other proteins in same PDB: d3t2qa1, d3t2qa2, d3t2qa4, d3t2qa5, d3t2qb1, d3t2qb2, d3t2qb4, d3t2qb5, d3t2qc1, d3t2qc2, d3t2qc4, d3t2qc5, d3t2qd1, d3t2qd2, d3t2qd4, d3t2qd5 automated match to d1jz7a5 complexed with 149, dms, mg, na |
PDB Entry: 3t2q (more details), 2.4 Å
SCOPe Domain Sequences for d3t2qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2qa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3t2qa3:
View in 3DDomains from same chain: (mouse over for more information) d3t2qa1, d3t2qa2, d3t2qa4, d3t2qa5 |