Lineage for d3chbh_ (3chb H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 296866Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 296867Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 296868Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)
  8. 296873Domain d3chbh_: 3chb H: [24974]
    complexed with gal, glc, mes, nga, sia, unx; mutant

Details for d3chbh_

PDB Entry: 3chb (more details), 1.25 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d3chbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chbh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman

SCOP Domain Coordinates for d3chbh_:

Click to download the PDB-style file with coordinates for d3chbh_.
(The format of our PDB-style files is described here.)

Timeline for d3chbh_: