Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3t2pc1: 3t2p C:9-219 [249736] Other proteins in same PDB: d3t2pa2, d3t2pa3, d3t2pa4, d3t2pa5, d3t2pb2, d3t2pb3, d3t2pb4, d3t2pb5, d3t2pc2, d3t2pc3, d3t2pc4, d3t2pc5, d3t2pd2, d3t2pd3, d3t2pd4, d3t2pd5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3t2p (more details), 2.6 Å
SCOPe Domain Sequences for d3t2pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2pc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t2pc1:
View in 3D Domains from same chain: (mouse over for more information) d3t2pc2, d3t2pc3, d3t2pc4, d3t2pc5 |