Lineage for d3t2pb2 (3t2p B:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373010Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2373141Domain d3t2pb2: 3t2p B:220-333 [249732]
    Other proteins in same PDB: d3t2pa1, d3t2pa3, d3t2pa5, d3t2pb1, d3t2pb3, d3t2pb5, d3t2pc1, d3t2pc3, d3t2pc5, d3t2pd1, d3t2pd3, d3t2pd5
    automated match to d1jz8a1
    complexed with dms, ipt, mg, na

Details for d3t2pb2

PDB Entry: 3t2p (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with iptg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3t2pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2pb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3t2pb2:

Click to download the PDB-style file with coordinates for d3t2pb2.
(The format of our PDB-style files is described here.)

Timeline for d3t2pb2: