| Class b: All beta proteins [48724] (176 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (4 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
| Domain d3t2pa5: 3t2p A:731-1023 [249730] Other proteins in same PDB: d3t2pa1, d3t2pa2, d3t2pa3, d3t2pa4, d3t2pb1, d3t2pb2, d3t2pb3, d3t2pb4, d3t2pc1, d3t2pc2, d3t2pc3, d3t2pc4, d3t2pd1, d3t2pd2, d3t2pd3, d3t2pd4 automated match to d1jz8a4 complexed with dms, ipt, mg, na |
PDB Entry: 3t2p (more details), 2.6 Å
SCOPe Domain Sequences for d3t2pa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2pa5 b.30.5.0 (A:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvdeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t2pa5:
View in 3DDomains from same chain: (mouse over for more information) d3t2pa1, d3t2pa2, d3t2pa3, d3t2pa4 |