SCOP 1.69: Domain d3chbg_: 3chb G:

Lineage for d3chbg_ (3chb G:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)

8. Domain d3chbg_: 3chb G: [24973]

Details for d3chbg_

PDB Entry: 3chb, 1.25 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d3chbg_:

Sequence; same for both SEQRES and ATOM records:

>d3chbg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman

Timeline for d3chbg_:

• d3chbg_ first appeared (with stable ids) in SCOP 1.55
  
• d3chbg_ appears in SCOP 1.67
  
• d3chbg_ appears in SCOP 1.71
  
• d3chbg_ appears in the current release, SCOPe 2.08