| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (8 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
| Domain d3t2oc5: 3t2o C:731-1023 [249720] Other proteins in same PDB: d3t2oa1, d3t2oa2, d3t2oa3, d3t2oa4, d3t2ob1, d3t2ob2, d3t2ob3, d3t2ob4, d3t2oc1, d3t2oc2, d3t2oc3, d3t2oc4, d3t2od1, d3t2od2, d3t2od3, d3t2od4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3t2o (more details), 1.85 Å
SCOPe Domain Sequences for d3t2oc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2oc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvdeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t2oc5:
View in 3DDomains from same chain: (mouse over for more information) d3t2oc1, d3t2oc2, d3t2oc3, d3t2oc4 |