Lineage for d3t2oc3 (3t2o C:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832611Domain d3t2oc3: 3t2o C:334-625 [249718]
    Other proteins in same PDB: d3t2oa1, d3t2oa2, d3t2oa4, d3t2oa5, d3t2ob1, d3t2ob2, d3t2ob4, d3t2ob5, d3t2oc1, d3t2oc2, d3t2oc4, d3t2oc5, d3t2od1, d3t2od2, d3t2od4, d3t2od5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3t2oc3

PDB Entry: 3t2o (more details), 1.85 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t2oc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2oc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3t2oc3:

Click to download the PDB-style file with coordinates for d3t2oc3.
(The format of our PDB-style files is described here.)

Timeline for d3t2oc3: