| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
| Protein automated matches [190075] (132 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
| Domain d3t2oc3: 3t2o C:334-625 [249718] Other proteins in same PDB: d3t2oa1, d3t2oa2, d3t2oa4, d3t2oa5, d3t2ob1, d3t2ob2, d3t2ob4, d3t2ob5, d3t2oc1, d3t2oc2, d3t2oc4, d3t2oc5, d3t2od1, d3t2od2, d3t2od4, d3t2od5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3t2o (more details), 1.85 Å
SCOPe Domain Sequences for d3t2oc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2oc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3t2oc3:
View in 3DDomains from same chain: (mouse over for more information) d3t2oc1, d3t2oc2, d3t2oc4, d3t2oc5 |