Lineage for d3t2oc1 (3t2o C:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775121Domain d3t2oc1: 3t2o C:13-219 [249716]
    Other proteins in same PDB: d3t2oa2, d3t2oa3, d3t2oa4, d3t2oa5, d3t2ob2, d3t2ob3, d3t2ob4, d3t2ob5, d3t2oc2, d3t2oc3, d3t2oc4, d3t2oc5, d3t2od2, d3t2od3, d3t2od4, d3t2od5
    automated match to d1f49a3
    complexed with dms, mg, na

Details for d3t2oc1

PDB Entry: 3t2o (more details), 1.85 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t2oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2oc1 b.18.1.0 (C:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t2oc1:

Click to download the PDB-style file with coordinates for d3t2oc1.
(The format of our PDB-style files is described here.)

Timeline for d3t2oc1: