SCOP 1.59: Domain d3chbe_: 3chb E:

Lineage for d3chbe_ (3chb E:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)

7. Species Vibrio cholerae [TaxId:666] [50209] (9 PDB entries)

8. Domain d3chbe_: 3chb E: [24971]

Details for d3chbe_

PDB Entry: 3chb, 1.25 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d3chbe_:

Sequence; same for both SEQRES and ATOM records:

>d3chbe_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman

Timeline for d3chbe_:

• d3chbe_ first appeared (with stable ids) in SCOP 1.55
  
• d3chbe_ appears in SCOP 1.57
  
• d3chbe_ appears in SCOP 1.61
  
• d3chbe_ appears in the current release, SCOPe 2.08