SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3t2oa2 (3t2o A:220-333)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030012Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2030471Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2030472Protein automated matches [254633] (8 species)
    not a true protein
  7. 2030551Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2030552Domain d3t2oa2: 3t2o A:220-333 [249707]
    Other proteins in same PDB: d3t2oa1, d3t2oa3, d3t2oa5, d3t2ob1, d3t2ob3, d3t2ob5, d3t2oc1, d3t2oc3, d3t2oc5, d3t2od1, d3t2od3, d3t2od5
    automated match to d1jz8a1
    complexed with dms, mg, na

Details for d3t2oa2

PDB Entry: 3t2o (more details), 1.85 Å

PDB Description: E. coli (lacZ) beta-galactosidase (S796D)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3t2oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2oa2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3t2oa2:

Click to download the PDB-style file with coordinates for d3t2oa2.
(The format of our PDB-style files is described here.)

Timeline for d3t2oa2: