Lineage for d3t2oa2 (3t2o A:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763012Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2763077Domain d3t2oa2: 3t2o A:220-333 [249707]
    Other proteins in same PDB: d3t2oa1, d3t2oa3, d3t2oa5, d3t2ob1, d3t2ob3, d3t2ob5, d3t2oc1, d3t2oc3, d3t2oc5, d3t2od1, d3t2od3, d3t2od5
    automated match to d1jz8a1
    complexed with dms, mg, na

Details for d3t2oa2

PDB Entry: 3t2o (more details), 1.85 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3t2oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2oa2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3t2oa2:

Click to download the PDB-style file with coordinates for d3t2oa2.
(The format of our PDB-style files is described here.)

Timeline for d3t2oa2: