| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
| Domain d3t2oa1: 3t2o A:13-219 [249706] Other proteins in same PDB: d3t2oa2, d3t2oa3, d3t2oa4, d3t2oa5, d3t2ob2, d3t2ob3, d3t2ob4, d3t2ob5, d3t2oc2, d3t2oc3, d3t2oc4, d3t2oc5, d3t2od2, d3t2od3, d3t2od4, d3t2od5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3t2o (more details), 1.85 Å
SCOPe Domain Sequences for d3t2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2oa1 b.18.1.0 (A:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t2oa1:
View in 3DDomains from same chain: (mouse over for more information) d3t2oa2, d3t2oa3, d3t2oa4, d3t2oa5 |