| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (8 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
| Domain d3t0dd5: 3t0d D:731-1023 [249699] Other proteins in same PDB: d3t0da1, d3t0da2, d3t0da3, d3t0da4, d3t0db1, d3t0db2, d3t0db3, d3t0db4, d3t0dc1, d3t0dc2, d3t0dc3, d3t0dc4, d3t0dd1, d3t0dd2, d3t0dd3, d3t0dd4 automated match to d1jz8a4 complexed with 149, dms, mg, na |
PDB Entry: 3t0d (more details), 1.93 Å
SCOPe Domain Sequences for d3t0dd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0dd5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvteatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t0dd5:
View in 3DDomains from same chain: (mouse over for more information) d3t0dd1, d3t0dd2, d3t0dd3, d3t0dd4 |