Lineage for d3t0dc1 (3t0d C:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384768Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2384791Domain d3t0dc1: 3t0d C:9-219 [249690]
    Other proteins in same PDB: d3t0da2, d3t0da3, d3t0da4, d3t0da5, d3t0db2, d3t0db3, d3t0db4, d3t0db5, d3t0dc2, d3t0dc3, d3t0dc4, d3t0dc5, d3t0dd2, d3t0dd3, d3t0dd4, d3t0dd5
    automated match to d1f49a3
    complexed with 149, dms, mg, na

Details for d3t0dc1

PDB Entry: 3t0d (more details), 1.93 Å

PDB Description: e.coli (lacz) beta-galactosidase (s796t) in complex with galactonolactone
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t0dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0dc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t0dc1:

Click to download the PDB-style file with coordinates for d3t0dc1.
(The format of our PDB-style files is described here.)

Timeline for d3t0dc1: