Lineage for d1tiih_ (1tii H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 296866Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 296929Protein Heat-labile toxin [50205] (2 species)
  7. 297046Species Escherichia coli, type IIB [TaxId:562] [50207] (3 PDB entries)
  8. 297056Domain d1tiih_: 1tii H: [24969]
    Other proteins in same PDB: d1tii.1

Details for d1tiih_

PDB Entry: 1tii (more details), 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib

SCOP Domain Sequences for d1tiih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiih_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IIB}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOP Domain Coordinates for d1tiih_:

Click to download the PDB-style file with coordinates for d1tiih_.
(The format of our PDB-style files is described here.)

Timeline for d1tiih_: