SCOPe 2.05: Domain d1tiig_: 1tii G:

Lineage for d1tiig_ (1tii G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IIB [TaxId:562] [50207] (3 PDB entries)

8. Domain d1tiig_: 1tii G: [24968]
   Other proteins in same PDB: d1tii.1

Details for d1tiig_

PDB Entry: 1tii, 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib

PDB Compounds: (G:) heat labile enterotoxin type iib

SCOPe Domain Sequences for d1tiig_:

Sequence; same for both SEQRES and ATOM records:

>d1tiig_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

Timeline for d1tiig_:

• d1tiig_ first appeared (with stable ids) in SCOP 1.55
  
• d1tiig_ appears in SCOPe 2.04
  
• d1tiig_ appears in SCOPe 2.06
  
• d1tiig_ appears in the current release, SCOPe 2.08