Lineage for d1tiig_ (1tii G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13676Protein Heat-labile toxin [50205] (2 species)
  7. 13778Species Escherichia coli, type IIB [TaxId:562] [50207] (1 PDB entry)
  8. 13782Domain d1tiig_: 1tii G: [24968]
    Other proteins in same PDB: d1tii.1

Details for d1tiig_

PDB Entry: 1tii (more details), 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib

SCOP Domain Sequences for d1tiig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiig_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IIB}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOP Domain Coordinates for d1tiig_:

Click to download the PDB-style file with coordinates for d1tiig_.
(The format of our PDB-style files is described here.)

Timeline for d1tiig_: