![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3t0bd4: 3t0b D:626-730 [249678] Other proteins in same PDB: d3t0ba1, d3t0ba3, d3t0ba5, d3t0bb1, d3t0bb3, d3t0bb5, d3t0bc1, d3t0bc3, d3t0bc5, d3t0bd1, d3t0bd3, d3t0bd5 automated match to d1jz8a2 complexed with dms, ipt, mg, na |
PDB Entry: 3t0b (more details), 2.4 Å
SCOPe Domain Sequences for d3t0bd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0bd4 b.1.4.0 (D:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3t0bd4:
![]() Domains from same chain: (mouse over for more information) d3t0bd1, d3t0bd2, d3t0bd3, d3t0bd5 |