Lineage for d3t0bc5 (3t0b C:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782136Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2782191Domain d3t0bc5: 3t0b C:731-1023 [249674]
    Other proteins in same PDB: d3t0ba1, d3t0ba2, d3t0ba3, d3t0ba4, d3t0bb1, d3t0bb2, d3t0bb3, d3t0bb4, d3t0bc1, d3t0bc2, d3t0bc3, d3t0bc4, d3t0bd1, d3t0bd2, d3t0bd3, d3t0bd4
    automated match to d1jz8a4
    complexed with dms, ipt, mg, na

Details for d3t0bc5

PDB Entry: 3t0b (more details), 2.4 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796t) iptg complex
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t0bc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0bc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvteatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3t0bc5:

Click to download the PDB-style file with coordinates for d3t0bc5.
(The format of our PDB-style files is described here.)

Timeline for d3t0bc5: