| Class b: All beta proteins [48724] (176 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (24 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
| Domain d3t0bb1: 3t0b B:9-219 [249665] Other proteins in same PDB: d3t0ba2, d3t0ba3, d3t0ba4, d3t0ba5, d3t0bb2, d3t0bb3, d3t0bb4, d3t0bb5, d3t0bc2, d3t0bc3, d3t0bc4, d3t0bc5, d3t0bd2, d3t0bd3, d3t0bd4, d3t0bd5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3t0b (more details), 2.4 Å
SCOPe Domain Sequences for d3t0bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0bb1 b.18.1.0 (B:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t0bb1:
View in 3DDomains from same chain: (mouse over for more information) d3t0bb2, d3t0bb3, d3t0bb4, d3t0bb5 |