![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (125 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
![]() | Domain d3t0ba3: 3t0b A:334-625 [249662] Other proteins in same PDB: d3t0ba1, d3t0ba2, d3t0ba4, d3t0ba5, d3t0bb1, d3t0bb2, d3t0bb4, d3t0bb5, d3t0bc1, d3t0bc2, d3t0bc4, d3t0bc5, d3t0bd1, d3t0bd2, d3t0bd4, d3t0bd5 automated match to d1jz7a5 complexed with dms, ipt, mg, na |
PDB Entry: 3t0b (more details), 2.4 Å
SCOPe Domain Sequences for d3t0ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0ba3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3t0ba3:
![]() Domains from same chain: (mouse over for more information) d3t0ba1, d3t0ba2, d3t0ba4, d3t0ba5 |