Lineage for d3t0ac5 (3t0a C:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2053055Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2053056Protein automated matches [226849] (7 species)
    not a true protein
  7. 2053066Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2053081Domain d3t0ac5: 3t0a C:731-1023 [249654]
    Other proteins in same PDB: d3t0aa1, d3t0aa2, d3t0aa3, d3t0aa4, d3t0ab1, d3t0ab2, d3t0ab3, d3t0ab4, d3t0ac1, d3t0ac2, d3t0ac3, d3t0ac4, d3t0ad1, d3t0ad2, d3t0ad3, d3t0ad4
    automated match to d1jz8a4
    complexed with dms, mg, na

Details for d3t0ac5

PDB Entry: 3t0a (more details), 1.9 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796t)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t0ac5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0ac5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvteatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3t0ac5:

Click to download the PDB-style file with coordinates for d3t0ac5.
(The format of our PDB-style files is described here.)

Timeline for d3t0ac5: