Lineage for d3t0ab3 (3t0a B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832622Domain d3t0ab3: 3t0a B:334-625 [249647]
    Other proteins in same PDB: d3t0aa1, d3t0aa2, d3t0aa4, d3t0aa5, d3t0ab1, d3t0ab2, d3t0ab4, d3t0ab5, d3t0ac1, d3t0ac2, d3t0ac4, d3t0ac5, d3t0ad1, d3t0ad2, d3t0ad4, d3t0ad5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3t0ab3

PDB Entry: 3t0a (more details), 1.9 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796t)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3t0ab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0ab3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3t0ab3:

Click to download the PDB-style file with coordinates for d3t0ab3.
(The format of our PDB-style files is described here.)

Timeline for d3t0ab3: