![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3t0ab2: 3t0a B:220-333 [249646] Other proteins in same PDB: d3t0aa1, d3t0aa3, d3t0aa5, d3t0ab1, d3t0ab3, d3t0ab5, d3t0ac1, d3t0ac3, d3t0ac5, d3t0ad1, d3t0ad3, d3t0ad5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3t0a (more details), 1.9 Å
SCOPe Domain Sequences for d3t0ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0ab2 b.1.4.0 (B:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3t0ab2:
![]() Domains from same chain: (mouse over for more information) d3t0ab1, d3t0ab3, d3t0ab4, d3t0ab5 |