![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
![]() | Domain d3t0ab1: 3t0a B:9-219 [249645] Other proteins in same PDB: d3t0aa2, d3t0aa3, d3t0aa4, d3t0aa5, d3t0ab2, d3t0ab3, d3t0ab4, d3t0ab5, d3t0ac2, d3t0ac3, d3t0ac4, d3t0ac5, d3t0ad2, d3t0ad3, d3t0ad4, d3t0ad5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3t0a (more details), 1.9 Å
SCOPe Domain Sequences for d3t0ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0ab1 b.18.1.0 (B:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t0ab1:
![]() Domains from same chain: (mouse over for more information) d3t0ab2, d3t0ab3, d3t0ab4, d3t0ab5 |