SCOPe 2.05: Domain d3t09d5: 3t09 D:731-1023

Lineage for d3t09d5 (3t09 D:731-1023)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)

8. Domain d3t09d5: 3t09 D:731-1023 [249639]
   Other proteins in same PDB: d3t09a1, d3t09a2, d3t09a3, d3t09a4, d3t09b1, d3t09b2, d3t09b3, d3t09b4, d3t09c1, d3t09c2, d3t09c3, d3t09c4, d3t09d1, d3t09d2, d3t09d3, d3t09d4
   automated match to d1jz8a4
   complexed with 149, dms, mg, na

Details for d3t09d5

PDB Entry: 3t09, 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a) galactonolactone complex

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3t09d5:

Sequence; same for both SEQRES and ATOM records:

>d3t09d5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvaeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

Timeline for d3t09d5:

• d3t09d5 first appeared in SCOPe 2.04
  
• d3t09d5 appears in SCOPe 2.06
  
• d3t09d5 appears in the current release, SCOPe 2.08