![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Heat-labile toxin [50205] (2 species) |
![]() | Species Escherichia coli, type IB [TaxId:562] [50206] (23 PDB entries) |
![]() | Domain d1b44g_: 1b44 G: [24963] extended C-terminally with a peptide with anti-hsv activity |
PDB Entry: 1b44 (more details), 3.3 Å
SCOPe Domain Sequences for d1b44g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b44g_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag
Timeline for d1b44g_:
![]() Domains from other chains: (mouse over for more information) d1b44d_, d1b44e_, d1b44f_, d1b44h_ |