![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3t09a2: 3t09 A:220-333 [249621] Other proteins in same PDB: d3t09a1, d3t09a3, d3t09a5, d3t09b1, d3t09b3, d3t09b5, d3t09c1, d3t09c3, d3t09c5, d3t09d1, d3t09d3, d3t09d5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3t09 (more details), 1.75 Å
SCOPe Domain Sequences for d3t09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t09a2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3t09a2:
![]() Domains from same chain: (mouse over for more information) d3t09a1, d3t09a3, d3t09a4, d3t09a5 |