![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d3t08d5: 3t08 D:731-1023 [249619] Other proteins in same PDB: d3t08a1, d3t08a2, d3t08a3, d3t08a4, d3t08b1, d3t08b2, d3t08b3, d3t08b4, d3t08c1, d3t08c2, d3t08c3, d3t08c4, d3t08d1, d3t08d2, d3t08d3, d3t08d4 automated match to d1jz8a4 complexed with dms, ipt, mg, na |
PDB Entry: 3t08 (more details), 2 Å
SCOPe Domain Sequences for d3t08d5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t08d5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvaeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t08d5:
![]() Domains from same chain: (mouse over for more information) d3t08d1, d3t08d2, d3t08d3, d3t08d4 |