| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
| Domain d3t08c1: 3t08 C:9-219 [249610] Other proteins in same PDB: d3t08a2, d3t08a3, d3t08a4, d3t08a5, d3t08b2, d3t08b3, d3t08b4, d3t08b5, d3t08c2, d3t08c3, d3t08c4, d3t08c5, d3t08d2, d3t08d3, d3t08d4, d3t08d5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3t08 (more details), 2 Å
SCOPe Domain Sequences for d3t08c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t08c1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t08c1:
View in 3DDomains from same chain: (mouse over for more information) d3t08c2, d3t08c3, d3t08c4, d3t08c5 |