Lineage for d3t08b3 (3t08 B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832594Domain d3t08b3: 3t08 B:334-625 [249607]
    Other proteins in same PDB: d3t08a1, d3t08a2, d3t08a4, d3t08a5, d3t08b1, d3t08b2, d3t08b4, d3t08b5, d3t08c1, d3t08c2, d3t08c4, d3t08c5, d3t08d1, d3t08d2, d3t08d4, d3t08d5
    automated match to d1jz7a5
    complexed with dms, ipt, mg, na

Details for d3t08b3

PDB Entry: 3t08 (more details), 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a) iptg complex
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3t08b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t08b3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3t08b3:

Click to download the PDB-style file with coordinates for d3t08b3.
(The format of our PDB-style files is described here.)

Timeline for d3t08b3: