| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (16 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d3t08a4: 3t08 A:626-730 [249603] Other proteins in same PDB: d3t08a1, d3t08a3, d3t08a5, d3t08b1, d3t08b3, d3t08b5, d3t08c1, d3t08c3, d3t08c5, d3t08d1, d3t08d3, d3t08d5 automated match to d1jz8a2 complexed with dms, ipt, mg, na |
PDB Entry: 3t08 (more details), 2 Å
SCOPe Domain Sequences for d3t08a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t08a4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3t08a4:
View in 3DDomains from same chain: (mouse over for more information) d3t08a1, d3t08a2, d3t08a3, d3t08a5 |