SCOPe 2.05: Domain d3szkf_: 3szk F:

Lineage for d3szkf_ (3szk F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries)

8. Domain d3szkf_: 3szk F: [249599]
   Other proteins in same PDB: d3szka_, d3szkb_, d3szkd_, d3szke_
   automated match to d3ovub_
   complexed with hem

Details for d3szkf_

PDB Entry: 3szk, 3.01 Å

PDB Description: Crystal Structure of Human metHaemoglobin Complexed with the First NEAT Domain of IsdH from Staphylococcus aureus

PDB Compounds: (F:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3szkf_:

Sequence; same for both SEQRES and ATOM records:

>d3szkf_ b.1.28.1 (F:) automated matches {Staphylococcus aureus [TaxId: 196620]}
slkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkaevel
dintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqiddge
etnydytklvfakpiyndpsl

Timeline for d3szkf_:

• d3szkf_ first appeared in SCOPe 2.04
  
• d3szkf_ appears in SCOPe 2.06
  
• d3szkf_ appears in the current release, SCOPe 2.08