Lineage for d3szke_ (3szk E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687135Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries)
    Uniprot P68871
  8. 2687631Domain d3szke_: 3szk E: [249598]
    Other proteins in same PDB: d3szka_, d3szkc_, d3szkd_, d3szkf_
    automated match to d1dxtb_
    complexed with hem

Details for d3szke_

PDB Entry: 3szk (more details), 3.01 Å

PDB Description: Crystal Structure of Human metHaemoglobin Complexed with the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (E:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3szke_:

Sequence, based on SEQRES records: (download)

>d3szke_ a.1.1.2 (E:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
talwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgaf
sdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgkeftppvqaayq
kvvagvanala

Sequence, based on observed residues (ATOM records): (download)

>d3szke_ a.1.1.2 (E:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
talwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgaf
sdglahatlselhcdklhvdpenfrllgnvlvcvlahhfgkeftppvqaayqkvvagvan
ala

SCOPe Domain Coordinates for d3szke_:

Click to download the PDB-style file with coordinates for d3szke_.
(The format of our PDB-style files is described here.)

Timeline for d3szke_: