Lineage for d3szkc_ (3szk C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766796Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2766819Protein automated matches [191246] (3 species)
    not a true protein
  7. 2766833Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries)
  8. 2766834Domain d3szkc_: 3szk C: [249596]
    Other proteins in same PDB: d3szka_, d3szkb_, d3szkd_, d3szke_
    automated match to d3ovub_
    complexed with hem

Details for d3szkc_

PDB Entry: 3szk (more details), 3.01 Å

PDB Description: Crystal Structure of Human metHaemoglobin Complexed with the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (C:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3szkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szkc_ b.1.28.1 (C:) automated matches {Staphylococcus aureus [TaxId: 196620]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndpsl

SCOPe Domain Coordinates for d3szkc_:

Click to download the PDB-style file with coordinates for d3szkc_.
(The format of our PDB-style files is described here.)

Timeline for d3szkc_: