| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
| Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
| Protein automated matches [191246] (3 species) not a true protein |
| Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries) |
| Domain d3szkc_: 3szk C: [249596] Other proteins in same PDB: d3szka_, d3szkb_, d3szkd_, d3szke_ automated match to d3ovub_ complexed with hem |
PDB Entry: 3szk (more details), 3.01 Å
SCOPe Domain Sequences for d3szkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3szkc_ b.1.28.1 (C:) automated matches {Staphylococcus aureus [TaxId: 196620]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndpsl
Timeline for d3szkc_: