Lineage for d3sxpa_ (3sxp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095040Species Helicobacter pylori [TaxId:563041] [256091] (2 PDB entries)
  8. 2095041Domain d3sxpa_: 3sxp A: [249589]
    automated match to d4glla_
    complexed with nad

Details for d3sxpa_

PDB Entry: 3sxp (more details), 2.55 Å

PDB Description: Crystal Structure of Helicobacter pylori ADP-L-glycero-D-manno-heptose-6-epimerase (rfaD, HP0859)
PDB Compounds: (A:) ADP-L-glycero-D-mannoheptose-6-epimerase

SCOPe Domain Sequences for d3sxpa_:

Sequence, based on SEQRES records: (download)

>d3sxpa_ c.2.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]}
mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
dldytplydlesgikdylphihai

Sequence, based on observed residues (ATOM records): (download)

>d3sxpa_ c.2.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]}
mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
sgvynvgysqarsyneivsilkehlgdfkvtyikkhtqahieptildldytplydlesgi
kdylphihai

SCOPe Domain Coordinates for d3sxpa_:

Click to download the PDB-style file with coordinates for d3sxpa_.
(The format of our PDB-style files is described here.)

Timeline for d3sxpa_: