Lineage for d3swva_ (3swv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726283Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2726284Protein automated matches [191283] (3 species)
    not a true protein
  7. 2726288Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 2726296Domain d3swva_: 3swv A: [249587]
    automated match to d3ltla_

Details for d3swva_

PDB Entry: 3swv (more details), 3 Å

PDB Description: Crystal Structure of a domain of Brefeldin A-inhibited guanine nucleotide-exchange protein 2 (Brefeldin A-inhibited GEP 2) from Homo sapiens (Human), Northeast Structural Genomics Consortium target id HR5562A
PDB Compounds: (A:) Brefeldin A-inhibited guanine nucleotide-exchange protein 2

SCOPe Domain Sequences for d3swva_:

Sequence, based on SEQRES records: (download)

>d3swva_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fevikqqkeiiehgielfnkkpkrgiqflqeqgmlgtsvediaqflhqeerldstqvgdf
lgdsarfnkevmyayvdqldfcekefvsalrtflegfrlpgeaqkidrlmekfaaryiec
nqgqtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeyls
siyeeiegkkia

Sequence, based on observed residues (ATOM records): (download)

>d3swva_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fevikqqkeiiehgielfnkkpkrgiqflqeqgmlgtsvediaqflhqeerldstqvgdf
lgdsarfnkevmyayvdqldfcekefvsalrtflegfrlpgeaqkidrlmekfaaryiec
tlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylssiye
eiegkkia

SCOPe Domain Coordinates for d3swva_:

Click to download the PDB-style file with coordinates for d3swva_.
(The format of our PDB-style files is described here.)

Timeline for d3swva_: