Lineage for d3sv0a_ (3sv0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2984685Species Oryza sativa [TaxId:39947] [256089] (1 PDB entry)
  8. 2984686Domain d3sv0a_: 3sv0 A: [249582]
    automated match to d1ckia_

Details for d3sv0a_

PDB Entry: 3sv0 (more details), 2 Å

PDB Description: Crystal structure of casein kinase-1 like protein in plant
PDB Compounds: (A:) Casein kinase I-like

SCOPe Domain Sequences for d3sv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sv0a_ d.144.1.7 (A:) automated matches {Oryza sativa [TaxId: 39947]}
eprvgnkfrlgrkigsgsfgeiylgtniqtneevaiklenvktkhpqllyeskiyrilqg
gtgipnvrwfgvegdynvlvmdllgpsledlfnfcsrklslktvlmladqminrvefvhs
ksflhrdikpdnflmglgrranqvyiidfglakkyrdtsthqhipyrenknltgtaryas
vnthlgieqsrrddleslgyvlmyflrgslpwqglkagtkkqkyekisekkvatsiealc
rgyptefasyfhycrslrfddkpdysylkrlfrdlfiregfqfdyvfdwtilky

SCOPe Domain Coordinates for d3sv0a_:

Click to download the PDB-style file with coordinates for d3sv0a_.
(The format of our PDB-style files is described here.)

Timeline for d3sv0a_: