![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [256089] (1 PDB entry) |
![]() | Domain d3sv0a_: 3sv0 A: [249582] automated match to d1ckia_ |
PDB Entry: 3sv0 (more details), 2 Å
SCOPe Domain Sequences for d3sv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sv0a_ d.144.1.7 (A:) automated matches {Oryza sativa [TaxId: 39947]} eprvgnkfrlgrkigsgsfgeiylgtniqtneevaiklenvktkhpqllyeskiyrilqg gtgipnvrwfgvegdynvlvmdllgpsledlfnfcsrklslktvlmladqminrvefvhs ksflhrdikpdnflmglgrranqvyiidfglakkyrdtsthqhipyrenknltgtaryas vnthlgieqsrrddleslgyvlmyflrgslpwqglkagtkkqkyekisekkvatsiealc rgyptefasyfhycrslrfddkpdysylkrlfrdlfiregfqfdyvfdwtilky
Timeline for d3sv0a_: